Loading...
HomeMy WebLinkAbout2560462 - F.I. Received Doc. Phone: 049-4371447/9 Fax: 049-4371451 E-mail: info@clw.ie The Mews, 23 Farnham Street, Cavan, Co. Cavan CLW Environmental Planners Ltd. Directors: S. Clarke, O. Leddy B.Agr.Sc., P. Fay B.Agr.Sc. V.A.T. Reg. No. 8277204J Planning Department, Monaghan County Council, County Offices, The Glen, Monaghan. 10th March 2026 RE: Planning application for Fergal McCruddan. Development Address ~ Knocknagrave, Tydavnet, Co. Monaghan. Your Ref: 25/60462 Dear Sir/Madame I refer to the planning application for development on an existing poultry farm, made on behalf of Mr. Fergal McCruddan and your subsequent correspondence in relation to same dated 20th January last. Please find detailed below the response to the issues raised. 1. Section 15.13.2 ‘Intensive Agriculture, Poultry and Pig Installations’ of the Monaghan County Development Plan 2025-2031 states that ‘any development which will result in an increase in ammonia and/or nitrogen emissions within 10km of a European Site (Natura 2000 site) shall not be permitted.’ Planning Authority notes that the application site is located approximately 1.22km from Slieve Beagh SPA. Policy HCLP 8 states that ‘Any plan or project which is likely to impact on the conservation objectives of a Natura 2000 site shall be screened for Appropriate Assessment (AA) and where pertinent, a Stage 2 Appropriate Assessment (Natura Impact Statement) shall be undertaken in order to make a determination’. The Planning Authority notes from the submitted AA Scree ning opinion, prepared by Whitehill Environmental, that it is anticipated that ammonia production from the poultry enterprise will be reduced from a current estimate of 4536kg per annum to 2677.5kg per annum as a result of the introduction of a new manure removal system. It is not clear however, how these figures have been arrived at. In the interests of clarity and environment protection, and to ensure that the proposal complies with aforementioned Section 15.13.2 and Policy HCLP 8, the applicant is reques ted to provide further details regarding the source and rationale for the figures provided regarding current and proposed ammonia production at the site, and how they have been accurately compiled to inform the conclusions contained in the submitted AA Scr eening Report. Please refer to updated AA Screening Report enclosed. RECEIVED: 31/03/2026 Phone: 049-4371447/9 Fax: 049-4371451 E-mail: info@clw.ie The Mews, 23 Farnham Street, Cavan, Co. Cavan CLW Environmental Planners Ltd. Directors: S. Clarke, O. Leddy B.Agr.Sc., P. Fay B.Agr.Sc. V.A.T. Reg. No. 8277204J 2. In the interests of environmental protection, the applicant is requested to provide the following information; (i) A Nutrient Management Plan for the holding, taking into account all organic fertilisers, soiled waters and effluents produced by the bovine and poultry aspects of the enterprise that are intended to be spread on the holding. The proposed development is a standalone poultry farming activity /holding with no other activities carried out by the applicant. All poultry manure is to be moved off -site by the appointed contractor, with any soiled water to be applied to the applicant’s families’ lands. Detailed information (as per below has previously been submitted in this regard. RECEIVED: 31/03/2026 Phone: 049-4371447/9 Fax: 049-4371451 E-mail: info@clw.ie The Mews, 23 Farnham Street, Cavan, Co. Cavan CLW Environmental Planners Ltd. Directors: S. Clarke, O. Leddy B.Agr.Sc., P. Fay B.Agr.Sc. V.A.T. Reg. No. 8277204J (ii) A Construction Environmental Management Plan (CEMP), taking into account Inland Fisheries Ireland (IFI) guidance ‘Guidelines on Protection of Fisheries during Construction Works in and Adjacent to Waters 2016’. Please refer to enclosed Construction Environmental Management Plan. (iii) A Construction and Demolition and By-Products Waste Management Plan taking account of EPA guidance ‘Best Practice Guidelines for the preparation of resource & waste management plans for construction and demolition projects’ ( 2021). Please refer to enclosed Resourse Waste Management Plan. (iv) An Asbestos Survey and Removal Plan for the proposed demolition works. RECEIVED: 31/03/2026 Phone: 049-4371447/9 Fax: 049-4371451 E-mail: info@clw.ie The Mews, 23 Farnham Street, Cavan, Co. Cavan CLW Environmental Planners Ltd. Directors: S. Clarke, O. Leddy B.Agr.Sc., P. Fay B.Agr.Sc. V.A.T. Reg. No. 8277204J This house was completely replaced in the early 1990’s under planning ref: 90/565, and it is understood at this time no asbestos was used in its construction. It is proposed to complete an Asbestos survey in advance of demolition and submit to Monaghan Co.Co. (v) A Revised letter from CLR Co-Op detailing the arrangement to collect poultry litter on a weekly basis from the proposed development. Please refer to updated letter enclosed. 3. The Planning Authority notes that the applicant seeks to improve and existing access onto the local primary road (LP 1133 -0) to serve the proposed development. In accordance with Section 15.23.2 of the Monaghan County Development Plan 2025-2031, the minimum visibility splay requirement for accesses onto a local primary road is 2.4m’s X 70 metres. It is noted that the submitted site layout drawing indicates a ‘proposed approved 70m Sightline shown in yellow’ to the south of the entrance, however the location of this visibility splay is not clear or legible on submitted plans. In the interests of road safety, the applicant is required to submit the following information to ensure the application fully accords with section 15.27 and 15.23.2 of the Monaghan Cou nty Development Plan 2025-2031; (i) A revised site layout plan (1:500 scale) indicating how a clear and unobstructed visibility splays of 70m can be achieved at the proposed entry/exit point onto the adjoining public road. The required visibility splays should be provided from a point in the centre of the entrance, 2.4 metres from the road edge at a height of 1.05 metre to 2.0 metres above ground level to an object height of 1.05 metres to 2.0 metres above ground level in both directions. The submitted revised site layout plan should demonstrate all necessary site work, including the extent of the front boundary hedge and trees which would be required to be removed/trimmed, re-grading of side banks etc to achieve the required sight distances. (ii) Where the sight distances are not achievable within the applicant’s ownership, the applicant should submit legal agreements with adjoining landowners giving their consent for all necessary works to facilitate the required 70m sight distances, includin g removal/trimming of hedgerow/hedges, re-grading of side banks etc. The Applicant should note that legal agreements should be submitted using the Appendix 13 template ‘Form of Agreement in respect of forward and rear visibility’ as contained in the Monaghan County Development Plan 2025-2031. (iii) The applicant is also requested to submit a swept path analysis illustrating the turning movements of HGV vehicles (i) within the site and (ii) entering and exiting the site in both directions at the proposed entrance. Please refer to updated plans enclosed. RECEIVED: 31/03/2026 Phone: 049-4371447/9 Fax: 049-4371451 E-mail: info@clw.ie The Mews, 23 Farnham Street, Cavan, Co. Cavan CLW Environmental Planners Ltd. Directors: S. Clarke, O. Leddy B.Agr.Sc., P. Fay B.Agr.Sc. V.A.T. Reg. No. 8277204J 4. Section 15.13.1 ‘General Requirements for Agricultural Development’ of the Monaghan County Development Plan 2025-2031 stipulates that ‘where a development is proposed within 100m of any residential property not located on the holding within the rural area (i.e. outside of a designated settlement) written consent from the adjoining property owner stating there is no objection to the proposal and witnessed by a Solicitor or a Peace Commissioner must be provided.’ Planning Authority notes that there is a third party, albeit family owned, dwelling located approximately 84 metres east of the proposed development, however no written letter of consent has been provided with regard to same. The applicant is therefore requested to submit additional documentation to demonstrate full compliance with aforementioned section 15.13.1 and associated policy AGP 1. Please refer to letter of consent enclosed. 5. Policy LCP 1 and Section 15.22.4 of the Monaghan County Development Plan 2025 -2031 stipulates that all development proposals should be accompanied by comprehensive landscaping plan commensurate to the scale of development being proposed. Planning Authority notes that additional landscaping is proposed along the southwestern boundary of the site, however the proposed planting appears to be located outside the application site red line boundary. In addition, it is unclear from the details submitted as to how the ‘Landscaping Legend’ relates to the associated drawings in terms of the location and species of trees that are proposed to be planted along the site boundaries. Having regard to same, the applicant is requested to provide the following; (i) A comprehensive and costed, landscaping plan commensurate to the scale of development proposed, prepared by a suitably qualified, competent, technical professional with landscaping expertise. (ii) Landscaping plans shall include, as a minimum, the number, species, location, height at planting, height at maturity and an implementation timescale for all proposed planting. (iii) The new planting scheme should consist of local native plant types which will enhance the visual amenity and the biodiversity of the area. (iv) The removal of hedgerows to facilitate development must be clearly identified on the application drawings and a satisfactory, detailed replanting proposal submitted. The Applicant should note that a bond may be applied in the event of a grant of permission to ensure the satisfactory completion of the landscaping proposed. Please refer to Landscaping Plan enclosed. RECEIVED: 31/03/2026 Phone: 049-4371447/9 Fax: 049-4371451 E-mail: info@clw.ie The Mews, 23 Farnham Street, Cavan, Co. Cavan CLW Environmental Planners Ltd. Directors: S. Clarke, O. Leddy B.Agr.Sc., P. Fay B.Agr.Sc. V.A.T. Reg. No. 8277204J Should you have any queries in relation to this, or, require any further information please do not hesitate to contact me at the above number. Yours Faithfully, Paraic Fay B.Agr.Sc. RECEIVED: 31/03/2026 i Whitehill Environmental Noreen McLoughlin, MSc Environmental Consultant Whitehill Edgeworthstown Co. Longford  (087) 4127248 / (043) 6672775  noreen.mcloughlin@gmail.com A PPROPRIATE A SSESSMENT S CREENING R EPORT F OR A P ROPOSED D EVELOPMENT AT K NOCKNAGRAVE , T YDAVNET , C O M ONAGHAN All Maps and Aerial Photography used in this report are reproduced under Tailte Éireann License CYAL50368269 Fergal McCrudden c/o Paraic Fay C.L.W. Environmental Planners Ltd The Mews 23 Farnham Street November 2025 Revised January 2026 RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN ii T ABLE O F C ONTENTS 1 INTRODUCTION ___________________________________________________________________ 3 1.1 Background ................................................................................................................................. 3 1.2 Regulatory Context ..................................................................................................................... 3 2 METHODOLOGY __________________________________________________________________ 7 2.1 Appropriate Assessment ............................................................................................................. 7 2.2 Statement of Competency .......................................................................................................... 9 2.3 Desk Studies & Consultation ....................................................................................................... 9 2.4 Assessment Methodology ........................................................................................................... 9 3 SCREENING _____________________________________________________________________ 11 3.1 Development Description.......................................................................................................... 11 3.2 Site Location and Surrounding Environment ............................................................................. 14 3.3 Natura 2000 Sites Identified .......................................................................................................17 3.4 Impact Assessment ................................................................................................................... 20 3.5 Finding of No Significant Effects ............................................................................................... 23 4 APPROPRIATE ASSESSMENT CONCLUSION _____________________________________________ 24 A PPENDIX I – L OW E MISSION H OUSIN G ................................................................................. 25 A PPENDIX II - EPA F LOW C HART (2024) ............................................................................... 30 RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 3 1 I NTRODUCTION 1.1 B ACKGROUND Article 6 of the EU Habitat’s Directive (Council Directive 92/43/EEC) requires that all plans and projects be screened for potential impacts upon Special Areas of Conservation (SACs) or Special Protection Areas (SPAs). The aim of this screening process is to establish whether or not a full Appropriate Assessment of the proposed plan or project is necessary. A comprehensive assessment of the potential significant effects of a proposed development at an existing poultry farm in Knocknagrave, Tydavnet, Co. Monaghan on designated sites was carried out in November 2025 by Noreen McLoughlin, MSc, MCIEEM of Whitehill Environmental. This assessment allowed areas of potential ecological value and potential ecological constraints associated with this proposed development to be identified and it also enabled potential ecological impacts associated with the proposed development on designated sites to be assessed. It will allow Monaghan County Council, as the competent authority, to issue an Appropriate Assessment determination of the proposed development. This AA screening was updated following a Request for Further Information that was made by Monaghan County Council (Planning File: 25/60462). The location of the proposed development is within the Zone of Influence of sites designated under European Law. As such and in accordance with Article 6(3) of the EU Habitat’s Directive (Council Directive 92/43/EEC) regarding Appropriate Assessment, this screening exercise for Appropriate Assessment was carried out in order to identify whether any significant impacts on designated sites are likely. 1.2 R EGULATORY C ONTEXT R ELEVANT L EGISLATION The Birds Directive (Council Directive2009/147/EC) recognises that certain species of birds should be subject to special conservation measures concerning their habitats. The Directive requires that Member States take measures to classify the most suitable areas as Special Protection Areas (SPAs) for the conservation of bird species listed in Annex 1 of the Directive. SPAs are selected for bird species (listed in Annex I of the Birds Directive), that are regularly occurring populations of migratory bird species and the SPA areas are of international importance for these migratory birds. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 4 The EU Habitats Directive (92/43/EEC) requires that Member States designate and ensure that particular protection is given to sites (Special Areas of Conservation) which are made up of or support particular habitats and species listed in annexes to this Directive. Articles 6(3) and 6(4) of this Directive also call for the undertaking of an Appropriate Assessment for plans and projects not directly connected with or necessary to the management of, but which are likely to have a significant effect on any European designated sites (i.e. SACs and SPAs). The Water Framework Directive (WFD) (2000/60/EC), which came into force in December 2000, establishes a framework for community action in the field of water policy. The WFD was transposed into Irish law by the European Communities (Water Policy) Regulations 2003 (S.I. 722 of 2003). The WFD rationalises and updates existing legislation and provides for water management on the basis of River Basin Districts (RBDs). RBDs are essentially administrative areas for coordinated water management and are comprised of multiple river basins (or catchments), with cross-border basins (i.e. those covering the territory of more than one Member State) assigned to an international RBD. The aim of the WFD is to ensure that waters achieve at least good status by 2027 and that status does not deteriorate in any waters. Appropriate Assessment and the Habitats Directive Directive 92/43/EEC on the Conservation of Natural Habitats and Wild Fauna and Flora – the ‘Habitats Directive’ - provides legal protection for habitats and species of European importance. Article 2 of the Directive requires the maintenance or restoration of habitats and species of European Community interest, at a favourable conservation status. Articles 3 - 9 provide the legislative means to protect habitats and species of Community interest through the establishment and conservation of an EU-wide network of sites known as Natura 2000. Natura 2000 sites are Special Areas of Conservation (SACs) designated under the Habitats Directive and Special Protection Areas (SPAs) designated under the Conservation of Wild Birds Directive (79/409/EEC). Articles 6(3) and 6(4) of the Habitats Directive sets out the decision-making tests for plans or projects affecting Natura 2000 sites. Article 6(3) establishes the requirement for Appropriate Assessment: “Any plan or project not directly connected with or necessary to the management of the site but likely to have a significant effect thereon, either individually or in combination with other plans or projects, shall be subject to appropriate assessment of its implications for the site in view of the site's conservation objectives. In the light of the conclusions of the assessment of RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 5 the implications for the site and subject to the provisions of paragraph 4, the competent national authorities shall agree to the plan or project only after having ascertained that it will not adversely affect the integrity of the site concerned and, if appropriate, after having obtained the opinion of the general public.” Article 6(4) deals with the steps that should be taken when it is determined, as a result of appropriate assessment, that a plan/project will adversely affect a European site. Issues dealing with alternative solutions, imperative reasons of overriding public interest and compensatory measures need to be addressed in this case. Article 6(4) states: “If, in spite of a negative assessment of the implications for the site and in the absence of alternative solutions, a plan or project must nevertheless be carried out for imperative reasons of overriding public interest, including those of a social or economic nature, the Member States shall take all compensatory measures necessary to ensure that the overall coherence of Natura 2000 is protected. It shall inform the Commission of the compensatory measures adopted. Where the site concerned hosts a priority natural habitat type and/or a priority species, the only considerations which may be raised are those relating to human health or public safety, to beneficial consequences of primary importance for the environment or, further to an opinion from the Commission, to other imperative reasons of overriding public interest.” The Appropriate Assessment Process The aim of Appropriate Assessment is to assess the implications of a proposal in respect of a designated site’s conservation objectives. The ‘Appropriate Assessment’ itself is an assessment which must be carried out by the competent authority which confirms whether the plan or project in combination with other plans and projects will have an adverse impact on the integrity of a European site. Screening for Appropriate Assessment shall be carried out by the competent authority as set out in Section 177U(1) and (2) of the Planning and Development Act 2000 (as amended) as follows: ‘(1) A screening for appropriate assessment of a draft Land use plan or application for consent for proposed development shall be carried out by the competent authority to assess, in view of best scientific knowledge, if that Land use plan or proposed development, individually or in RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 6 combination with another plan or project is likely to have a significant effect on the European site. (2) A competent authority shall carry out a screening for appropriate assessment under subsection (1) before— (a) a Land use plan is made including, where appropriate, before a decision on appeal in relation to a draft strategic development zone is made, or (b) consent for a proposed development is given.’ The competent authority shall determine that an Appropriate Assessment is not required if it can be excluded, that the proposed development, individually or in combination with other plans or project will have a significant effect on a European site. Where the competent authority cannot exclude the potential for a significant effect on a European site, an Appropriate Assessment shall be deemed required. Where an Appropriate Assessment is required, the conclusions of the Appropriate Assessment Report (Natura Impact Statement (NIS)) should enable the competent authority to ascertain whether the plan or proposed development would adversely affect the integrity of the European site. If adverse impacts on the integrity of a European site cannot be avoided, then mitigation measures should be applied during the appropriate assessment process to the point where no adverse impacts on the site remain. Under the terms of the Habitats Directive consent can only be granted for a project if, as a result of the appropriate assessment either (a) it is concluded that the integrity of any European sites will not be adversely affected, or (b) after mitigation, where adverse impacts cannot be excluded, there is shown to be an absence of alternative solutions, and there exists imperative reasons of overriding public interest for the project should go ahead. Section 177(V) of the Planning and Development Act 2000 (as amended) outlines that the competent authority shall carry out the Appropriate Assessment, taking into account the Natura Impact Statement (amongst any other additional or supplemental information). A determination shall then be made by the competent authority in line with the requirements of Article 6(3) of the Habitats Directive as to whether the plan or proposed development would adversely affect the integrity of a European site, prior to consent being given. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 7 2 M ETHODOLOGY 2.1 A PPROPRIATE A SSESSMENT This Statement of Screening for Appropriate Assessment (Stage 1) has been prepared with reference to the following:  European Commission (2018). Managing Natura 2000 Sites: The Provisions of Article 6 of the ‘Habitats’ Directive 92/43/EEC.  European Commission (2021). Assessment of Plans and Projects Significantly Affecting Natura 2000 sites: Methodological Guidance on the Provisions of Article 6(3) and (4) of the Habitats Directive 92/43/EEC.  European Commission (2006). Nature and Biodiversity Cases: Ruling of the European Court of Justice.  European Commission (2007). Clarification of the Concepts of: Alternative Solution, Imperative Reasons of Overriding Public Interest, Compensatory Measures, Overall Coherence, Opinion of the Commission.  Department of Environment, Heritage and Local Government (2009). Appropriate Assessment of Plans and Projects in Ireland: Guidance for Planning Authorities. The EC Guidance sets out a number of principles as to how to approach decision making during the process. The primary one is ‘the precautionary principle’ which requires that the conservation objectives of Natura 2000 should prevail where there is uncertainty. When considering the precautionary principle, the emphasis for assessment should be on objectively demonstrating with supporting evidence that:  There will be no significant effects on a Natura 2000 site;  There will be no adverse effects on the integrity of a Natura 2000 site;  There is an absence of alternatives to the project or plan that is likely to have an adverse effect to the integrity of a Natura 2000 site; and  There are compensation measures that maintain or enhance the overall coherence of Natura 2000. This translates into a four stage process to assess the impacts, on a designated site or species, of a policy or proposal. The EC Guidance states that “each stage determines whether a further stage in the process is required”. Consequently, the Council may not need to proceed through all four stages in undertaking the Appropriate Assessment. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 8 The four-stage process is: Stage 1: Screening – The process which identifies the likely impacts upon a Natura 2000 site of a project or plan, either alone or in combination with other projects or plans, and considers whether or not these impacts are likely to be significant; Stage 2: Appropriate Assessment – The consideration of the impact on the integrity of the Natura 2000 site of the project or plan, either alone or in combination with other projects or plans, with respect to the site’s structure and function and its conservation objectives. Additionally, where there are adverse impacts, an assessment of the potential mitigation of those impacts; Stage 3: Assessment of Alternative Solutions – The process which examines alternative ways of achieving objectives of the project or plan that avoid adverse impacts on the integrity of the Natura 2000 site; Stage 4: Assessment where no alternative solutions exist and where adverse impacts remain – An assessment of the compensatory measures where, in the light of an assessment of imperative reasons of overriding public interest (IROPI), it is deemed that the project or plan should proceed. In complying with the obligations set out in Articles 6(3) and following the guidelines described above, this screening statement has been structured as a stage by stage approach as follows:  Description of the proposed project;  Identification of the Natura 2000 sites close to the proposed development;  Identification and description of any individual and cumulative impacts on the Natura 2000 sites likely to result from the project;  Assessment of the significance of the impacts identified above on site integrity. Exclusion of sites where it can be objectively concluded that there will be no significant effects. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 9 2.2 S TATEMENT OF C OMPETENCY This AA Screening report was carried out by Noreen McLoughlin, BA, MSc, MCIEEM. Noreen has an honours degree in Zoology and an MSc in Freshwater Ecology from Trinity College, Dublin and she has been a full member of the Chartered Institute of Ecology and Environmental Management for over nineteen years. Noreen has over 21 years’ experience as a professional ecologist in Ireland. 2.3 D ESK S TUDIES & C ONSULTATION Information on the site and the area of the proposed development was studied prior to the completion of this statement. The following data sources were accessed in order to complete a thorough examination of potential impacts:  National Parks and Wildlife Service - Aerial photographs and maps of designated sites, information on habitats and species within these sites and information on protected plant or animal species, conservation objectives, site synopses and standard data forms for relevant designated sites.  Environmental Protection Agency (EPA)- Information pertaining to water quality, geology and licensed facilities within the area;  Myplan.ie – Mapped based information;  National Biodiversity Data Centre (NBDC) – Information pertaining to protected plant and animal species within the study area;  CLW Environmental Planners – Site plans, development description and information on potential emissions.  Monaghan County Council – Information on planning history in the area for the assessment of cumulative impacts. 2.4 A SSESSMENT M ETHODOLOGY The proposed development was assessed to identify its potential ecological impacts and from this, the Zone of Influence (ZoI) of the proposed development was defined. Based on the potential impacts and their ZoI, the Natura 2000 sites potentially at risk from direct, indirect or in-combination impacts were identified. The assessment considered all potential impact sources and pathways connecting the proposed development to Natura 2000 sites, in view of the conservation objectives supporting the favourable conservation condition of the site’s Qualifying Interests (QIs) or Special Conservation Interests (SCIs). The conservation objectives relating to each Natura 2000 site and its QIs/SCIs are cited generally for SACs as “to maintain or restore the favourable conservation condition of the RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 10 Annex I habitat(s) and/or Annex II species for which the SAC has been selected”, and for SPAs “to maintain or restore the favourable conservation condition of the bird species listed as Special Conservation Interests for this SPA”. As defined in the Habitat’s Directive, the favourable conservation status of a habitat is achieved when:  Its natural range and area it covers within that range is stable or increasing;  The specific structure and functions which are necessary for its long-term maintenance exist and are likely to continue to exist for the foreseeable future; The favourable conservation status of a species is achieved when:  The population dynamics data on the species concerned indicate that it is maintaining itself on a long-term basis as a viable component of its natural habitats;  The natural range of the species is neither being reduced nor is likely to be reduced for the foreseeable future;  There is, and will probably continue to be, a sufficiently large habitat to maintain its populations on a long-term basis. Where site-specific conservation objectives (SSCOs) have been prepared for a European site, these include a series of specific attributes and targets against which effects on conservation condition, or integrity, can be measured. Where potential significant effects are identified, then these SSCOs should be considered in detail. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 11 3 S CREENING 3.1 D EVELOPMENT D ESCRIPTION Mr Fergal McCrudden is applying to Monaghan County Council for planning permission for a development at his existing poultry farm in Knocknagrave, Tydavnet, Co. Monaghan. Planning permission is being sought here for the demolition of an existing 14,000 bird layer house with deep pit manure storage and the construction of two 14,000 bird layer houses (Multi-tier Aviary System). The new house will be constructed with a manure removal system (removed weekly) and this will reduce the overall emissions from the farm from 4,536kg ammonia per annum to 2,677.5kg ammonia per annum. The details of the proposed system showing evidence of reduction are presented in Appendix I. An extract from the planning drawings can be seen in Figure 1. Figure 1 – Proposed Site Plan (McCarron Chartered Building Surveyors) The poultry farm will operate for the production of eggs for consumption, with birds moved in at approximately 16 weeks and moved out at end of lay approximately 56-60 weeks later. The spent poultry litter and manure will be removed weekly from the farm by specialised contractors whereupon it will be used as an organic fertiliser on farms in accordance with S.I. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 12 113 of 2022. All records for the movement of fertiliser will be kept on site and presented to the Department of Agriculture, Food and Marine as requested. Washwater from the site will be spread on the applicants’ family lands. Construction methods for the new structures will be standard and will follow best practice guidelines at all stages. All structures will be complaint with the recommendations of the Department of Agriculture, Food and the Marine. The operation of the farm and all its associated activities will be done in accordance with S.I. 113 of 2022. Clean surface water from the site will be directed to a local land drain via a silt trap. S.I. 113 OF 2022 The European Union (Good Agricultural Practice for Protection of Waters) Regulations 2022 provides a basic set of measures to ensure the protection of waters, including drinking water sources, against pollution caused by nitrogen and phosphorus from agricultural sources, with the primary emphasis being on the management of livestock manures and other fertilisers. The purpose of these Regulations is to give effect to Ireland’s Nitrates Action Programme. This directive outlines measures that must be followed during the land-spreading of manure. These measures are summarised in the points below.  The amount of livestock manure applied in any year to land on a holding, together with that deposited to land by livestock, shall not exceed an amount containing 170 kg nitrogen per hectare.  The spreading of any organic fertiliser during certain times of the year is prohibited.  Farmers must keep within the overall maximum fertilisation rates for nitrogen and phosphorus.  Farmers must have sufficient storage capacity to meet the minimum requirements of the regulations.  All storage facilities must be kept leak proof and structurally sound.  Records for the movement of fertilisers must be kept.  Chemical fertilisers, livestock manure and other organic fertilisers, effluents and soiled water must be spread as accurately and as evenly as possible.  An upward-facing splash plate or sludge irrigator on a tanker or umbilical system must not be used for the spreading of organic fertiliser or soiled water.  Chemical fertilisers, livestock manure, soiled water or other organic fertilisers must not be spread when: o The land is waterlogged; o The land is flooded, or it is likely to flood; RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 13 o The land is frozen, or covered with snow; o Heavy rain is forecast within 48 hours; o The ground slopes steeply and there is a risk of water pollution, when factors such as surface run-off pathways, the presence of land drains, the absence of hedgerows to mitigate surface flow, soil condition and ground cover are taken into account.  Chemical fertilisers must not be spread on land within 2 metres of a surface watercourse. Table 1 shows the buffer zones for various water bodies (lakes, rivers, wells etc.). Soiled water, effluents, farmyard manures or other organic fertilisers must not be spread inside these buffer zones. Water Feature Buffer Zone Any water supply source providing 100m3 or more of water per day, or serving 500 or more people 200m (or as little as 30m where a local authority allow) Any water supply source providing 10m3 or more of water per day, or serving 50 people or more 100m (or as little as 30m where a local authority allows) Any other water supply for human consumption 25m (or as little as 15m where a local authority allows) Lake shoreline or a turlough likely to flood 20m Exposed cavernous or karstified limestones features 15m Any surface watercourse where the slope towards the watercourse exceeds 10% 10m Any other surface waters 5m Table 1 – Requirements for the Application of Fertilisers and Soiled Water as set out in S.I. 113 of 2022 Prior to its approval, a Natura Impact Statement was prepared for the Nitrates Action Programme (NAP) by RPS (2022). This Natura Impact Statement considered the potential of the measures proposed within the NAP to give rise to adverse effects on the integrity of European Sites, with regard to their qualifying interests, associated conservation status and the overall site integrity, alone and in combination with other relevant plans and programmes. The NIS concluded that the adoption of the NAP will not adversely affect the integrity of any European Site either alone or in combination with other relevant plans or programmes and subject to securing the mitigation measures prescribed in the NIS. The applicant is fully aware of his obligations under S.I. 113 of 2022 and he will meet all the requirements under this Directive with the proposed application. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 14 3.2 S ITE L OCATION AND S URROUNDING E NVIRONMENT The site in question is approximately 0.56ha and it is located in a rural area within the townlands of Knocknagrave. Access to the site is via the existing entrance into the farm and this entrance is just west off a local, third-class road. The site is situated 3.8km north of Tydavnet and 5.3km south-west of Emyvale. The main land-use surrounding the application site is agriculture and improved agricultural grassland is the dominant habitat locally and this habitat largely surrounds the site. Other natural habitats represented in the area include areas of semi-improved and wet grasslands, areas of mixed woodland and scrub, along with hedgerows, treelines and watercourses. Site location maps can be seen in Figures 2 and 3 whilst an aerial photograph of the site and its surrounding habitats can be seen in Figure 4. Figure 2 – Map showing the Location of the Proposed Development Site (Pinned) RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 15 Figure 3 – Map showing the Location of the Proposed Development Site (Outlined in Red) H ABITATS WITHIN THE S ITE The application site does not lie within or adjacent to any area that has been designated for nature conservation purposes. The site encompasses an existing poultry farm and the dominant habitat within the farm site currently is buildings and artificial surfaces, i.e., the existing poultry house, access roads and concrete aprons. The additional poultry house will be constructed in an area of improved grassland that lies adjacent to the existing house. The site boundaries consist of hedgerows. W ATER F EATURES AND QUALITY The application site lies within the Lough Neagh and Lower Bann Hydrometric Area (03) and Catchment (03), and the Mountain Water Sub-Catchment (010) and Sub-Basin (030). There are drainage ditches close to the site and clean surface water from the site will be directed to these local drains. These drains lead to the Knocknagrave Stream, which is 37m south of the site. The Knocknagrave Stream flows east and then north to join the Mountain Water River at a point c1.1km north-east of the application site. The Mountain Water River is a tributary of the Ulster Blackwater. The EPA have classified the ecological status of the Knocknagrave Stream and its tributaries, along with the Mountain Water River as being of good ecological status. Under the requirements of the Water Framework Directive, this is satisfactory and this status must be maintained. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 16 Figure 4 – Aerial Photograph of the Site (Outlined in Red) and its Surrounding Habitats RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 17 3.3 N ATURA 2000 S ITES I DENTIFIED In accordance with the guidelines issued by the Department of the Environment and Local Government, a list of Natura 2000 sites within 15km of the proposed development have been identified and described according to their site synopsis, qualifying interests and conservation objectives. In addition, any other sites further than this, but potentially within its zone of interest were also considered. The zone of impact may be determined by an assessment of the connectivity between the application site and the designated areas by virtue of hydrological connectivity, atmospheric emissions, flight paths, ecological corridors etc. For significant effects to arise, there must be a potential impact facilitated by having a source, i.e., the proposed development and activities arising out of its construction or operation, a receptor, i.e., the European site and its qualifying interests and a subsequent pathway or connectivity between the source and receptor, e.g., a water course. The likelihood for significant effects on the European site will largely depend on the characteristics of the source (e.g., nature and scale of the construction works), the characteristics of the existing pathway and the characteristics of the receptor, e.g., the sensitivities of the Qualifying Interests (habitats or species) to changes in water quality. There are three Natura 2000 designated sites (including former European sites in Northern Ireland) within 15km of the application site. These designated areas and their closest points to application site are summarised in Table 2 and maps showing their locations relative to the application site are shown in Figures 5 and 6. A full description of these sites can be read on the websites of the National Parks and Wildlife Service (npws.ie) and the Joint Nature Conservation Committee (jncc.defra.gov.uk). Site Name & Code Distance Qualifying Interests Screened In - Out Slieve Beagh SPA 004167 1.1km west  Hen Harrier Circus cyaneus Screened Out – There is no hydrological connectivity between the proposed construction works site and this SPA, therefore significant effects upon this site arising from emissions to water will not arise. The overall emissions from this proposed development will be lower than that previously permitted, therefore significant effects upon this SPA will not arise. Slieve Beagh SAC UK0016622 6.8km west  Natural dystrophic lakes and ponds  European dry heaths Screened Out – There is no hydrological connectivity between the proposed RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 18 construction works site and this SAC, therefore significant effects upon this site arising from emissions to water will not arise. The overall emissions from this proposed development will be lower than that previously permitted, therefore significant effects upon this SAC will not arise. Slieve Beagh- Mullaghafad- Lisnaskea SPA UK9020302 5km west  Hen Harrier Circus cyaneus Screened Out – There is no hydrological connectivity between the proposed construction works site and this SPA, therefore significant effects upon this site arising from emissions to water will not arise. The overall emissions from this proposed development will be lower than that previously permitted, therefore significant effects upon this SPA will not arise. Table 2 – Natura 2000 Sites within 15km of Application Site s Figure 5 – The Application Site (Red Dot) in relation to the Natura 2000 Sites within 15km RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 19 Figure 5 – The Application Site (Red Dot) in relation to the Slieve Beagh SPA RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 20 3.4 I MPACT A SSESSMENT The potential significant effects of the proposed development on the Natura 2000 sites within 15km are considered below. Describe the individual elements of the project (either alone or in combination with other plans or projects) likely to give rise to impacts on nearby Natura 2000 site: The construction and operation of the proposed development at Knocknagrave will have no significant effects upon the designated sites identified. There are no individual elements of the proposed project that are likely to give rise to negative impacts on these Natura 2000 sites. There will be no impacts upon designated habitats or species arising from the predicted emissions from this facility. There is an adequate distance between the proposed development site and all designated areas to ensure that no direct impacts will occur. There are other agricultural activities ongoing close to the current application site, therefore cumulative impacts arising from the operation of these farms together were considered. All farms, regardless of whether licensed by the EPA or not, are required to operate within the legalisation defined in S.I. 113 of 2022 regarding manure storage, minimisation of soiled water and general good agricultural practice, etc. Therefore, cumulative impacts arising from the combined operation of these activities with the proposed operation of the poultry farm at Knocknagrave will be negligible. The land-spreading of the poultry manure produced at the proposed facility has also been considered as part of this process. Records for the distribution and movement of all the manure produced will be kept on site and presented to the Department of Agriculture, Food and Marine if necessary. All organic fertilisers will replace the use of chemical fertiliser; therefore, there will be no overall increase in the amount of nutrients spread. The wash water generated during the maintenance of the facility will be land-spread on the applicant’s family lands. Land-spreading will only be done on areas of improved agricultural grasslands. The receipt lands are not adjacent to or connected to any Natura 2000 site. The use of these lands for land-spreading of water will have no impacts upon the integrity or conservation objectives of any Natura 2000 site. All land-spreading will be done in accordance with the Nutrient Management Plan for the farm and in accordance with S.I. 113 of 2022. All farmers that receive the manure from the proposed farm will do so under the European Union (Good Agricultural Practice for the Protection of Waters) Regulations 2022. Upon the receipt of the manure, they will be informed of their obligation under this legalisation. Compliance with these regulations will minimise cumulative impacts as well as any impacts upon water quality. Describe any likely direct, indirect or secondary impacts of the project (either alone or in combination with other plans or projects) on the nearby Natura 2000 sites by virtue of: Size and scale: Having regards to the small size and scale of the development in relation to the overall size of the Natura 2000 sites identified, then the likelihood of any direct, indirect or cumulative impacts upon this designated site is low. Land-take: There will be no land-take from any designated site. There will be no interference with the boundaries of any designated site. There will be no loss of any undesignated priority habitats. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 21 Distance from Natura 2000 site or key features of the site: There are three Natura 2000 sites within 15km of the application site. The closest site is the Slieve Beagh SPA and this SPA is 1.1km west of the site. In this instance, having regards to the fact that emissions following this development will decrease, significant effects upon this site and its QIs will not arise. Resource requirements (water abstraction etc.): No resources will be taken from any Natura 2000 site and there are no resource requirements that will impact upon any designated site. Emissions: The EPA have recently produced guidance documents for the assessment of impacts of emissions on Natura 2000 sites (See Appendix II - Assessment of the Impact of Ammonia and Nitrogen on Natura 2000 sites from Intensive Agriculture Installations, EPA 2021, updated 2024). This document contains a step-by-step assessment process which allows the applicant to ascertain the level of assessment and information needed when determining potential effects from emissions on Natura 2000 sites. Step 6 of the flow chart (Appendix I) makes a provision for applicants to demonstrate that the emissions from the new installations will result in an overall reduction in emissions from the baseline numbers. The proposed development consists of the demolition of an existing poultry house that accommodates c14,000 birds and the construction of two new houses with a multi-tier system. Each house will accommodate 14,000 birds. Despite the increase in numbers, the new and more modern houses will result in an overall decrease in ammonia emissions from the farm compared to the current baseline level, as manure will be removed weekly. The current house (House type HE2.100) accommodates up to 14,400 birds at 0.315kg ammonia / bird / year with a total load of 4,536kg ammonia per year. The two new houses (HE2.3 and HE2.3.1, Specification OW 2004.09.V1) will have an emission factor of 0.09kg / bird, with a total load of 2,677.5kg ammonia per year. This is a reduction of 1,858.5kg ammonia per year compared to current baseline levels. As the final emissions from the farm upon completion of the construction and upgrading works will be lower than that previously permitted, detailed atmospheric modelling is not required in this instance. Details on the proposed housing are included in Appendix I. Excavation requirements: Excavated material from the construction will be used on site. Bare soil will be reseeded straight away where appropriate. Any remaining soil will be disposed of in a responsible manner in a licensed facility away from any designated sites. In-Combination / Cumulative Impacts: The proposed application was considered in combination with other developments or proposed developments in the Knocknagrave / Tydavnet areas and the surroundings townlands. There are no past or pending applications that could lead to cumulative impacts upon the Natura 2000 sites when considered in combination with this current application. Any future individual application that has the potential to impact upon a Natura 2000 site will be subject to Appropriate Assessment as required under Articles 6(3) of the Habitats Directive. As overall ammonia emissions are decreasing, cumulative impacts with other intensive agricultural installations will not arise. Transportation requirements: There will be no additional transportation requirements resulting from the proposed development and associated works that will have any impact upon the Natura 2000 sites identified. Duration of construction, operation, decommissioning etc: Once construction begins, it should be complete within one year. RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 22 Describe any likely changes to the nearby Natura 2000 sites arising as a result of: Reduction of habitat area: The proposed development lies outside the boundaries of the Natura 2000 sites identified in Section 3.3. There will be no reduction of designated habitat area or habitats used by any protected bird species. There will be no impacts upon the qualifying interest of any SAC / SPA. Disturbance to key species: There will be no direct disturbance to any species listed in Annex I of the Birds Directive or Annex II of the Habitats Directive. Habitat or species fragmentation: There will be no habitat or species fragmentation within any SAC or SPA. No ecological corridors between the proposed site and any designated area will be damaged or destroyed. Reduction in species density: There will be no reduction in species density. Changes in key indicators of conservation value (water quality etc.): There will be no negative impacts upon surface or ground water quality. There will be no negative impacts upon the water quality in any designated site. Describe any likely impacts on the nearby Natura 2000 sites as a whole in terms of: Interference with the key relationships that define the structure or function of the site: It is not considered likely that there will be any impacts on the key relationships that define the structure or function of the Natura 2000 sites identified. Provide indicators of significance as a result of the identification of effects set out above in terms of: Loss - Estimated percentage of lost area of habitat: None Disruption & disturbance / Fragmentation: None Change to key elements of the site (e.g. water quality etc.): None RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 23 3.5 F INDING OF N O S IGNIFICANT E FFECTS Finding of No Significant Effects Report Matrix Name of project Development at an Existing Farm at Knocknagrave, Tydavnet, Co. Monaghan (Construction of Two Replacement Poultry Houses) Name and location of Natura 2000 site There are three Natura 2000 sites within 15km of the application site. The closest site is the Slieve Beagh SPA and this SPA is 1.1km west of the site. In this instance, having regards to the fact that emissions following this development will decrease, significant effects upon this site and its QIs will not arise. Description of project A Small Scale Agricultural Development Is the project directly connected with or necessary to the management of the site? No Are there other projects or plans that together with project being assessed could affect the site? No The Assessment of Significance of Effects Describe how the project is likely to affect the Natura 2000 site Having regard to the location, nature and scale of the proposed development, it is considered that there is no potential for significant effects either from the proposed development on its own or in combination with other plans and projects. Explain why these effects are not considered significant Not applicable as there is no potential for negative impacts Describe how the project is likely to affect species designated under Annex II of the Habitats Directive. No impacts likely Data Collected to Carry out the Assessment Who carried out the assessment Noreen McLoughlin, MSC, MCIEEM. Consultant Ecologist Sources of data NPWS, EPA, National Biodiversity Data Centre, Monaghan County Council Level of assessment completed Stage1 Appropriate Assessment Screening Where can the full results of the assessment be accessed and viewed Full results included RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 24 4 A PPROPRIATE A SSESSMENT C ONCLUSION In accordance with Article 6(3) of the Habitats Directive, the relevant case law, established best practice and the precautionary principle, this AA Screening Report has examined the details of the project in relation to the relevant Natura 2000 sites within 15km of the application site. At this stage of the AA process, it is for the competent authority, i.e., Monaghan County Council, to carry out the screening for AA and to reach one of the following determinations: a) AA of the proposed development is required if it cannot be excluded, on the basis of objective information, that the proposed development, individually or in combination with other plans or projects, will not have a significant effect on any European sites; b) AA of the proposed development is not required if it can be excluded, on the basis of objective information, that the proposed development, individually or in combination with other plans or projects, will not have a significant effect on any European sites. It is of the opinion of the author that an AA of the proposed development is not required as it can be excluded, on the basis of objective information provided in this report, that the proposed development, individually or in combination with other plans or projects, will not have a significant effect on any European sites. __________________________________ Noreen McLoughlin, MSc, MCIEEM. Ecologist. (PI Insurance details available on request) RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 25 A PPENDIX I – L OW E MISSION H OUSING RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 26 RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 27 RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 28 RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 29 RECEIVED: 31/03/2026 A PPROPRIATE A SSESSMENT S CREENING OF A D EVELOPMENT IN T YDAVNET , C O . M ONAGHAN 30 A PPENDIX II - EPA F LOW C HART (2024) RECEIVED: 31/03/2026 Phone: 049-4371447/9 Fax: 049-4371451 E-mail: info@clw.ie The Mews, 23 Farnham Street, Cavan, Co. Monaghan CLW Environmental Planners Ltd. Directors: S. Clarke, O. Leddy B.Agr.Sc., P. Fay B.Agr.Sc. V.A.T. Reg. No. 8277204J Construction and Environmental Management Plan (C.E.M.P.) For Mr. Fergal McCruddan At Knocknagrave, Tydavnet, Co. Monaghan. 12/03/2025 RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 2 Applicant: Mr. Fergal McCruddan Knocknagrave, Tydavnet, Co. Monaghan. Proposed Development: Planning permission to, to demolish 1 No. existing poultry house and to construct 2 No. Poultry house together with all ancillary structures and site works associated with the above development on an existing poultry farm at Knocknagrave, Tydavnet, Co. Monaghan. Location: Knocknagrave, Tydavnet, Co. Monaghan. RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 3 Background: The following Construction and Environmental Management Plan (C.E.M.P.) has been completed in support of a planning application to Monaghan Co. Co. for the proposed development. 1. Introduction CLW Environmental Planners Ltd. been commissioned to prepare this Construction Environmental Management Plan (CEMP) on behalf of Mr. Fergal McCruddan, as Developer and Applicant for the proposed development of 2 No. poultry houses and associated works. Planning permission has been applied for the proposed developments and associated works on an existing poultry farm on agricultural lands at Knocknagrave, Tydavnet, Co. Monaghan. This CEMP has been prepared to communicate key planning and environmental obligations relating to the management of the construction phase of the Proposed Development. It comprises general measures and a series of discipline-specific measures that align with the proposed mitigation and monitoring measures described in the EIAR for the Proposed Development. This CEMP is a ‘live’ document, which shall be updated by the Developer and the appointed construction contractor and/or overseeing engineer as the project is progressed. In particular, the CEMP will be updated to ensure the requirements of all relevant planning conditions are incorporated. 1.1 Objectives This CEMP outlines the approach to the management and minimisation of environmental impacts during the construction phase, with the primary aim of avoiding, reducing or offsetting any adverse impacts. The CEMP serves as a consistent point of reference for environmental considerations throughout the construction period for the Main Contractor, developer and site engineer. The Developer and the appointed Main Contractor are committed to undertaking the management and mitigation measures detailed in this CEMP. RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 4 1.2 Roles and Responsibilities The anticipated roles and responsibilities of the key parties involved in the management of environmental issues during the construction works are set out in Table 1 below. Some roles have still to be finalised pending receipt of planning permission. However, it should be noted that all members of staff are responsible for ensuring the requirements of the CEMP and associated construction plans are followed. Table 1: Roles and Responsibilities Position Name Contact Details Project Manager TBC TBC Environmental Officer / Coordinator Paraic Fay C/O CLW Environmental Planners ltd. Project Ecologist Noreen McLoughlin C/o Whitehill Environmental Other Relevant Persons Demolition Contractor TBC TBC Any changes in roles and responsibilities will be identified and clearly communicated to those affected. The responsibilities of the Project Manager / Site engineer will include: • Implement the CEMP and all associated management procedures and mitigation; • To be the overall accountable person for the environmental compliance of the operations during the construction phase, including to ensure works are conducted in accordance with the relevant environmental requirements of the application and consent documentation and any other regulatory and contractual requirements; • To ensure that relevant staff have received appropriate environmental training; and • Manage the requirements of the CEMP during the course of the construction phase; • Maintaining, inspecting and updating the CEMP and other relevant documents; • Liaise with and provide advice to staff, sub-contractors and other relevant parties with regards to the environmental risks and controls for tasks; • Monitor the performance of activities to ensure that identified risks and controls are implemented effectively; • Undertake routine site inspections, initiate appropriate actions, and complete a weekly environmental inspection report; • Management of the environmental monitoring programme including noise, dust, and provide status reports, as appropriate; • Conduct environmental audits as required by the CEMP, to include audits of subcontractors and suppliers, as appropriate; • Assist in the investigation and resolution of complaints and incidents; • Documenting and maintain records of above audits, inspections and reports securely; and • Notify the Project Manager or their appointed compliance representative of any deficiencies in the performance of the CEMP, so that necessary improvements can be implemented. RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 5 2. Site Location and Surrounding Environment The site in question is approximately 0.56ha and it is located in a rural area within the townlands of Knocknagrave. Access to the site is via the existing entrance into the farm and this entrance is just west off a local, third-class road. The site is situated 3.8km north of Tydavnet and 5.3km south -west of Emyvale. The main land-use surrounding the application site is agriculture and improved agricultural grassland is the dominant habitat locally and this habitat largely surrounds the site. Other natural habitats represented in the area include areas of semi-improved and wet grasslands, areas of mixed woodland and scrub, along with hedgerows, treelines and watercourses. Site location maps can be seen in Figures 2 and 3 whilst an aerial photograph of the site and its surrounding habitats can be seen in Figure 4. Figure 1 – Map showing the Location of the Proposed Development Site (Pinned) RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 6 Figure 2 – Map showing the Location of the Proposed Development Site (Outlined in Red) Habitats within the Site The application site does not lie within or adjacent to any area that has been designated for nature conservation purposes. The site encompasses an existing poultry farm and the dominant habitat within the farm site currently is buildings and artificial surfaces, i.e., the existing poultry house, access roads and concrete aprons. The additional poultry house will be constructed in an area of improved grassland that lies adjacent to the existing house. The site boundaries consist of hedgerows. Water Features and Quality The application site lies within the Lough Neagh and Lower Bann Hydrometric Area (03) and Catchment (03), and the Mountain Water Sub-Catchment (010) and Sub-Basin (030). There are drainage ditches close to the site and clean surface water from the site will be directed to these local drains. These drains lead to the Knocknagrave Stream, which is 37m south of the site. The Knocknagrave Stream flows east and then north to join the Mountain Water River at a point c1.1km north -east of the application site. The Mountain Water River is a tributary of the Ulster Blackwater. The EPA have classified the ecological status of the Knocknagrave Stream and its tributaries, along with the Mountain Water River as being of good ecological status. Under the requirements of the Water Framework Directive, this is satisfactory and this status must be maintained. RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 7 Figure 3 – Aerial Photograph of the Site (Outlined in Red) and its Surrounding Habitats RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 8 3. Site Preliminaries / Site Safety The proposed development is to be undertaken on existing poultry farm site. The Project Supervisor Construction Stage (PSCS) will be responsible for Health and Safety on the site and the site health and safety statement should be referred to . With the exception of asbestos, which will be the subject of an independent survey, subject to planning permission and prior to the implementation of the proposed demolition plan, no specific high risk / hazardous issues were identified at the planning sta ge however specific care and attention should be given to; • Overhead power lines • Watercourses adjoining the site Figure 4 – Aerial Photograph of the Site (Outlined in Red) and its Surrounding Habitats © Google River Na nny RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 9 4. Construction and Environmental Management Plan (C.E.M.P.) Objectives The primary objective of this Construction and Environmental Management Plan (C.E.M.P.) is to ensure that the proposed works are carried out with minimal adverse impact on any sensitive receptor(s), including, • The local environment. • The local road network • Local sensitive receptors (dwelling houses etc.) The prevention of adverse impact can be minimized by; ➢ The proper and sequential scheduling of site activities. ➢ Proper management of on-site activities. 5. Construction and Environmental Management Plan (C.E.M.P.): • 5.1 Site Authorisation / Pre- Approvals The required authorisation (Planning permission) has been applied for. Planning permission has previously been obtained from Monaghan Co. Co. (for a similar development) and an I.E. Licence has been granted by the E.P.A., for developments and operational activities on site. All works are to be completed in accordance with the conditions of any planning permission. This Construction and Environmental Management Plan (C.E.M.P.) may be reviewed depending on any relevant conditions and/or requirements expressed therein. No soil / soil & stone (Excl. purchased quarry stone) is to be imported onto the site and / or exported form the farm, therefore there are no additional Cert of Registration / Waste Permit requirements. The elimination of the need for import/export of soil material will also prevent the introduction / exporting of any invasive species. RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 10 • Site Plan as submitted RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 11 • 5.2 Overall Site Management The Main Contractor / Developer / Engineer will emphasise the importance of good housekeeping during the development phase. Housekeeping is an important part of good environmental practice and it helps everyone to maintain a more efficient and safer site. The site should be tidy, secure, and have clear access routes that are well signposted. The appearance of a tidy, well managed site can reduce the likelihood of theft, vandalism or complaints. The Main Contractor / Developer / Engineer will ensure that they: • Adequately plan the site with designated area of materials and waste storage; • Segregate different types of waste as it is produced and arrange frequent removal; • Keep the Site and external areas clean and tidy; • Ensure no wind blown litter or debris leaves the Site; • Use covered skips and bins; • Ensure that materials and plant storage areas are properly managed. Lightweight materials to be covered with sheeting and secured as required; • Maintain haul routes in a clean and tidy condition; • Ensure adequate space is given for the safe refuelling of site vehicles with appropriate protections in place for refuelling operations; • Keep roads free from mud using a road sweeper; and • Ensure the Site is secure. Working Hours: The proposed typical working hours would be: • 08:00hrs to 19:00 hours Monday – Friday; and • 08:00hrs to 14:00 hours Saturday. No work will be carried out on Sundays or bank holidays and the Site will remain secure when construction is not taking place. No work, or other activity that could reasonably be expected to cause annoyance to residents in the vicinity (including deliveries), will take place on site between 19:00 hours and 08:00 hours. RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 12 • 5.3 Site Clearance and Preparation / Enabling works. Site Entrance : The proposed site is to be accessed from an existing entrance onto the local road . Site Preparation: As detailed in the planning drawings this is an existing developed site, with minimal additional site works required. Tree and vegetation removal (if and where applicable) will be limited to only essential areas. The trees are programmed to be felled outside the bird nesting season (in accordance with the Wildlife Act 1976, as amended). RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 13 • 5.4 Construction The proposed development is a typical agricultural development, and similar to that previously carried out by the developer on the existing/adjacent site. A significant proportion of the construction requirements are prefabricated off-site and only require assembly on site, this significantly reducing potential waste streams. No significant hazardous waste streams will arise from the development to be completed. • It is vital that there is no deterioration in water quality in local watercourses. This will protect both habitats and species that are sensitive to pollution. Therefore, strict controls of erosion, sediment generation and other pollutants associated with the construction process should be implemented where necessary, including the provision of, silt traps or geotextile curtains to reduce and intercept sediment release into any local watercourses. The protection of water quality in this area is vital. • The applicant must follow the guidelines set out in the Department of Agriculture’s Explanatory Handbook for Good Agricultural Practice Regulations. • The proposed storage tanks must adhere to the Department of Agriculture’s Farm Building and Structures Specifications. Before use, they should undergo an integrity test that is performed by a suitably qualified person. They should be inspected regularly for deficiencies. • The applicant must ensure that any excavated soil is used / disposed of responsibly. Its disposal should not lead to the loss or damage of any natural or semi-natural habitats elsewhere. It should not be spread close to any local watercourse as it may result in an increase in the sediment load of that watercourse. • Fuels, oils, greases and hydraulic fluids must be stored in bunded compounds well away from watercourses. Refuelling of machinery, etc., should be carried out in bunded areas. Stockpile areas for sands and gravel should be kept to a minimum size, well away from any drain or watercourse. • Any hedgerows that remain should be protected and maintained where possible. They should be carefully cordoned off from the development activities on site. If possible, a natural verge should be allowed to remain along these hedgerows. This will maintai n the biodiversity on the site once the development is operational. It is illegal to remove hedgerows and trees during the bird nesting season. • Any landscaping should involve the planting of native Irish species that are indigenous to the site. The characteristics of newly planted hedgerows should mimic those in the surrounding area. • Bare soil should be seeded as soon as possible with grass seed. This will minimise erosion into local drains and watercourses. All wastes arising on the site are to be managed in accordance with the Construction Waste Management Plan. All complaints (if any) received during construction to be recorded, documented and addressed in line with the complaints record sheet enclosed. RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 14 6. Mitigation Measures In order to avoid any reductions in water quality in the area surrounding the proposed development, a number of good practice measures should be implemented and followed. Measures have also been suggested that will help to protect the local biodiversity of the surrounding area and to ensure the protection of local wildlife. The primary parties responsible for the implementation of these measures include the applicant himself, the project manager and the site engineer. In order to minimise emissions from the poultry facility at Knocknagrave and in order to protect certain designated sites and species, a number of mitigation measures must be implemented / followed, that will help to protect the local biodiversity of the surrounding area and to ensure the protection of local wildlife. These are outlined below ➢ The proposed structures will be constructed to Department of Agriculture, Food and Rural Development Standards for the construction of farm buildings. ➢ A dedicated soiled water tank will be provided on site which will collect any soiled water associated with the washing of same. All soiled water will be applied to the lands farmed by the applicant’s family in accordance with S.I. 588 of 2025, as amended. ➢ All roof water and uncontaminated storm water will discharge, to the local water course/storm water drainage system via the existing / proposed EPA Licenced emission points. These discharge point(s) will be visually inspected on a weekly basis for any signs of contamination i.e. visual and or odour, in line with the requirements of the existing E.P.A. Licence where applicable. ➢ The proposed developments have been designed so as to minimise the amount of soiled water generated on the farm. The area associated with the loading and unloading of birds and loading of manure leaving the proposed farm will be concreted with a dedicated soiled water storage tank provided, thus ensuring all soiled water is collected and that there is no possibility of contaminated storm water entering the clean storm water discharge system. ➢ All potentially polluting liquids (fuels, disinfectants chemicals etc.) to be stored in an appropriately bunded area in line with E.P.A . Licence requirements. ➢ Asbestos survey to be completed in advance of any demolition and the results of same to be incorporated not the Environmental Management Pan / Waste management plan as applicable. RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 15 The applicant must follow; ➢ The requirements as detailed in S.I. 588 of 2025 and the guidelines set out in the Department of Agriculture’s Explanatory Handbook for Good Agricultural Practice Regulations. ➢ The requirements as detailed in the E.P.A. Licence (P1081-01) as issued to the farm. ➢ The Construction and Demolition Waste Management Plan as detailed in the EIAR. ➢ Guidelines on Protection of Fisheries During Construction works in and adjacent to Waters 2016. 7. Conclusion: Due to the nature of the proposed development, completion of an agricultural development, with no significant excavation, and where a significant proportion of the development can be pre -fabricated off-site, there are no areas of significant concern with regard to the proposed development. The measures as outlined in this proposed Construction and Environmental Management Plan (C.E.M.P.) will ensure that the activity is carried out in accordance with appropriate practices and ensuring no significant impact on the local environment. Date: __12/03/2026_________ RECEIVED: 31/03/2026 Construction and Environmental Management Plan (C.E.M.P.) for Proposed Poultry House and associated works at Knocknagrave, Tydavnet, Co. Monaghan. 12th March 2026 (Rev. 1) Page no. 16 Appendix No. 1 Resourse Waste Management Plan. RECEIVED: 31/03/2026 Phone: 049-4371447/9 Fax: 049-4371451 E-mail: info@clw.ie The Mews, 23 Farnham Street, Cavan, Co. Cavan CLW Environmental Planners Ltd. Directors: S. Clarke, O. Leddy B.Agr.Sc., P. Fay B.Agr.Sc. V.A.T. Reg. No. 8277204J Resourse and Waste Management Plan For Proposed Development On Existing Poultry Farm At Knocknagrave, Tydavnet, Co. Monaghan. 12/03/2026 RECEIVED: 31/03/2026 Resourse and Waste Management Plan for Proposed development on Poultry Farm at Knocknagrave, Tydavnet, Co. Monaghan 12/03/2026 Page no. 2 Applicant: Mr. Fergal McCruddan, Knocknagrave, Tydavnet, Co. Monaghan. Proposed Development: Demolish 1 No. existing poultry house and to construct 2 No. Poultry houses together with all ancillary structures and site works associated with the above development on an existing poultry farm at Knocknagrave, Tydavnet, Co. Monaghan. at Location: Knocknagrave, Tydavnet, Co. Monaghan. RECEIVED: 31/03/2026 Resourse and Waste Management Plan for Proposed development on Poultry Farm at Knocknagrave, Tydavnet, Co. Monaghan 12/03/2026 Page no. 3 Background: The following Resourse and Waste Management Plan (RWMP) has been completed in accordance with the EPA, Best Practice Guidelines for the preparation of Resourse and Waste Management Plans for Construction and Demolition Projects, EPA 2021. The project description, Roles and Responsibilities (incl. Management) have been detailed in the aforementioned CEMP. Introduction and Purpose of the RWMP. The management of C&D waste on this site should reflect the waste management hierarchy, with waste prevention and minimisation being the first priority succeeded by reuse and recycling. The subsequent use of recycled materials in reconstruction works also reduces the quantities of waste which ultimately needs to be consigned to landfill sites. In this phase of the development, the proposed development has been subdivided into 3 areas of work for the purposes of this plan; 1. Demolition of Existing Structures. 2. Site Development 3. Construction of poultry house, ancillary store and associated works. Prevention of Waste: The primary effort therefore should be to engage in waste prevention and reduce the amount of waste generated in the first place i.e. minimise the resources needed to do the job. Prevention is financially advantageous as it reduces the purchase of construction materials and reduces the need to remove wastes from the site. The prevention of waste can be minimized by; ➢ Renovating existing buildings where appropriate. ➢ Re-using materials where appropriate. ➢ Re-cycling wastes where appropriate. ➢ Waste disposal as a last resort. RECEIVED: 31/03/2026 Resourse and Waste Management Plan for Proposed development on Poultry Farm at Knocknagrave, Tydavnet, Co. Monaghan 12/03/2026 Page no. 4 Renovation: which retains and repairs existing structural and decorative elements, with the introduction only where necessary of new items, contributes greatly to a reduction in C&D waste arising. While the developments to be demolished have been maintained and upgraded through the years they are now reaching the end of their useful life, and further renovation/repair is not economically viable. Reuse of Waste: Material that is generated should be reused on site or salvaged for subsequent reuse to the greatest extent possible and disposal should only be considered as a last resort. Initiatives should be put in place to maximise the efficient use/reuse of materials. Innovative initiatives to avoid the need for disposal should be investigated. Recycling of Waste: In relation to the small volume of waste which cannot be used on site there are a number of established markets available for the beneficial use of this C&D waste: ➢ waste timber can be recycled as shuttering or hoarding, or sent for reprocessing as medium density fibreboard; ➢ waste concrete can be utilised as fill material for roads or in the manufacture of new concrete when arising at source subject to compliance with local and national requirements as outlined in relevant regulations. All C&D waste from the proposed development (excl. clean soil and stone) will be moved off site by an approved permitted contractor, unless otherwise agreed with Monaghan Co. Co. ➢ in addition, the technology for the segregation and recovery of stone, for example, is well established, readily accessible and there is a large reuse market for aggregates as fill for roads and other construction projects. Bitmac and Asphalt can also be recycled in roads projects. Overall Management of C&D Waste on the Farm: As this is a typical agricultural development, there are no waste streams with the potential for significant adverse environmental impact. The site owner, is experienced at carrying out similar development projects on this, or other farms, and will be responsible for the management of C & D waste from this farm. All external contractors to be used will b e experienced with regard to poultry farm developments. RECEIVED: 31/03/2026 Resourse and Waste Management Plan for Proposed development on Poultry Farm at Knocknagrave, Tydavnet, Co. Monaghan 12/03/2026 Page no. 5 Demolition Plan: This phase of the proposed development will involve the demolition of 1 No. Poultry House and ancillary store/structures. It is important to emphasise the potential for certain procedures to contribute to a reduction in excessive material wastage on site. The demolition of the buildings will be carried out in the following way; 1. Emptying of all feed storage bins and implementation of rodent control programme on site. (Follow Bord Bia approved rodent control programme that was implemented on-site when the farm was operational). 2. Removal of any remaining manure/soiled water from the house/soiled water storage tanks and allocation of same to customer farmers in accordance with S.I. 588 of 2025, as amended as per normal agricultural practice. 3. Disconnection of services (E.S.B., Water etc.) 4. Identification of any Hazardous wastes on site. A site specific Asbestos survey isa to be completed in advance of demolition works and the results of same are to be integrated into the CEMP where applicable/appropriate. This would include Asbestos and Fluorescent light tubes. Asbestos to be taken down, wrapped and moved off-site by an approved specialist contractor. 5. Identification, removal and segregation of any re -usable and/or saleable equipment/fixtures/fittings. 6. Removal of any remaining fixtures and fittings (incl. electrical) and segregation into recyclable and/or disposal. 7. Removal and appropriate handling and storage of roof sheeting.. 8. Removal of Building superstructure and separation into timber, steel, rubble and other (insulation etc.). 9. Proper removal of same off-site to authorised sites via appropriately registered and authorised contractors. Note: Designated skips/storage areas to be provided for different waste streams. RECEIVED: 31/03/2026 Resourse and Waste Management Plan for Proposed development on Poultry Farm at Knocknagrave, Tydavnet, Co. Monaghan 12/03/2026 Page no. 6 Site - Development Plan: The proposed development is to be completed on a brown field area, in close proximity to , and replacing the existing poultry farm structures. This will involve excavating the site of the proposed developments to facilitate site leveling requirements and the construction of foundations. This will involve the excavation of a certain amount of clean soil and stone. This material will be used to level low-lying parts of the site. Construction Plan: Key Materials / Quantities: It is important to emphasise the potential for certain purchasing procedures to contribute to a reduction in excessive material wastage on site. Examples include: ➢ ordering materials on an "as needed" basis to prevent oversupply; ➢ purchasing coverings, panelling or other materials in shape, dimensions and form that minimises the creation of excessive scrap waste on site; ➢ ensuring correct storage and handling of construction materials to minimise generation of damaged materials/waste ➢ ensuring correct sequencing of operations. Design Approach: The proposed development of a regular shaped building, similar, and in some cases identical construction methods to that previously completed on this site and/or other similar poultry farms, will minimise the amount of waste material on the site. A significant amount of materials can be manufactured to the required size off site. In order to minimize wastage and other adverse impacts; ➢ where possible all concrete and aggregates will be ordered and supplied to exactly meet requirements. ➢ The proposed steel superstructure for the buildings will be made to order off site, and will only require erection on site, thus eliminating any waste. ➢ The roofing timbers can be ordered to size thus eliminating the need for cutting and wastage. ➢ All internal fixtures and fittings will be made to order off site and delivered to the site for installation. ➢ Any wastes that may arise on site will be appropriately stored, recycled where possible with any remaining wastes disposed of as previously outlined. RECEIVED: 31/03/2026 Resourse and Waste Management Plan for Proposed development on Poultry Farm at Knocknagrave, Tydavnet, Co. Monaghan 12/03/2026 Page no. 7 Construction and Demolition Waste Types and projected disposal/recovery routes: ➢ Metal and Electrical - To be removed, segregated and stored for re-use on the farm or recycling – McElvaney Waste and Recycling – WCP/MH/5/0089/01 ➢ Fluorescent Tubes - McElvaney Waste and Recycling subsequently sent to Enva Ireland Ltd. WCP- DC-08-1116-01, Clonminam Industrial Estate, Portlaoise, Co. Laois. ➢ Insulation/Timber - Excess to be removed off-site by McElvaney Waste Recycling – WCP/MH/5/0089/01 ➢ General Waste` - To be removed offsite by McElvaney Waste Recycling – WCP/MH/5/0089/01 ➢ Soil/Stone - To be used as infill material as part of proposed site works. ➢ Asbestos` - To be removed offsite by Harte Demolition Ltd. – NWCPO-20-12484-01 (or other approved contractor) * All waste materials to be transported by the appointed, authorised and permitted contractor to approved sites as detailed in the accompanying Waste Collection Permit. RECEIVED: 31/03/2026 Resourse and Waste Management Plan for Proposed development on Poultry Farm at Knocknagrave, Tydavnet, Co. Monaghan 12/03/2026 Page no. 8 Conclusion: Due to the nature of the proposed development, i.e. agricultural, there are no areas of significant concern with regard to the proposed development. The volume of waste emanating from the proposed works will be minimized by optimizing the construction process and pre-fabricating a significant proportion of the house off-site. The operator is greatly experienced at overseeing similar developments on this, and other poultry farms and will be in charge of the management of the construction waste management plan. Appropriate records are to be maintained of all materials sent off site for recycling/disposal. Signed: Date: __12/03/2026_________ RECEIVED: 31/03/2026 Resourse and Waste Management Plan for Proposed development on Poultry Farm at Knocknagrave, Tydavnet, Co. Monaghan 12/03/2026 Page no. 9 Attachment No. 1 Waste Record Sheet RECEIVED: 31/03/2026 EPA - RWMP BEST PRACTICE GUIDELINES 44 APPENDIX D RESOURCE AND WASTE INVENTORY TEMPLATE LoW Code Description Volume Generated (tonnes) Prevention (tonnes) (non-waste) Reused (tonnes) (non-waste) Recycled (tonnes) (waste) Recovered11 (tonnes) (waste) Disposed (tonnes) (waste) Unit Cost Rate (€/tonne) Total Cost (€) 17 01 01 Concrete 17 01 02 Bricks 17 01 03 Tiles and Ceramics 17 02 01 Wood 17 02 02 Glass 17 02 03 Plastic 17 03 02 Bituminous Mixtures 17 04 01 Copper, Bronze, Brass 17 04 02 Aluminium 17 04 03 Lead 17 04 04 Zinc 17 04 05 Iron and Steel 17 04 06 Tin 17 04 07 Mixed Metals 17 04 11 Cables 17 05 04 Soil and Stone 17 06 04 Insulation Material 11 Recovered here includes energy recovery, backfilling and other recovery. RECEIVED: 31/03/2026 EPA - RWMP BEST PRACTICE GUIDELINES 45 LoW Code Description Volume Generated (tonnes) Prevention (tonnes) (non-waste) Reused (tonnes) (non-waste) Recycled (tonnes) (waste) Recovered11 (tonnes) (waste) Disposed (tonnes) (waste) Unit Cost Rate (€/tonne) Total Cost (€) 17 08 02 Gypsum 17 09 04 Mixed C&D Waste 17 01 06*Mixtures of, or separate fractions of concrete, bricks, tiles and ceramics containing hazardous substances 17 02 04*Glass, plastic and wood containing or contaminated with hazardous substances 17 03 01*Bituminous mixtures containing coal tar 17 04 09*Metal waste contaminated with hazardous substances 17 05 03*Soil and stones containing hazardous substances 17 06 05*Construction materials containing asbestos Other resources (non- waste materials) (specify as needed) Other wastes (specify as needed)RECEIVED: 31/03/2026 T/A Poultry Manure Supplies (PMS) Mount Louise, Smithboro, Co. Monaghan, Ireland. Planning Application 27/03/2026 Dear Sir/Madame, CLR Co-op Ltd. will be collecting the litter generated from the proposed development of 2 poultry houses at the farm of Fergal Mc Crudden, Knocknagrave, Tydavnet, Co. Monaghan. CLR Co-op are in a position to collect all manure on a weekly basis. CLR Co-op are a registered contractor with the Department of Agriculture, Food and The Marine for the transport of animal by-products (poultry litter) DAFM Reference No. HAC 2342. All necessary paperwork is and will be maintained, including an annual Record 3 form submitted to Department of Agriculture, Food and the Marine. Poultry litter is currently delivered to a number of mushroom compost yards, and with significant demand for this poultry litter it is intended that the additional litter generated on this poultry farm will be accommodated in these compost yards. The following yards are currently supplied by CLR Co-op. • Carbury Mushrooms , Derrinturn, Carbury, Co. Kildare. • Custom Compost, Gorey, Co. Wexford. • Newry Organic Fertilisers, Mayobridge, Co. Down. Poultry Litter is considered a much needed raw material for the mushroom industry with considerable demand at present. Yours faithfully, James O’Harte CLR Co-op Ltd Board Members: Mark McElvaney, Michael McDonnell, Eamon Clerkin, Andy Boylan, Sean McKenna, Stepehen Hall and James O’ Harte. Reg. No5329.Address: Edraguil, Rockcorry, Co. Monaghan. Chicken Litter Re-Cycling Co Op Society Limited RECEIVED: 31/03/2026 location of site notice Access via existing Agricultural Entrance N Aco Drain to perimeter of concrete apron All concrete apron wastewater is to drain to Aco Channels and Wastewater Tank Site Plan Scale 1:500 New hedgerow planting to new site boundary shall incorporate native hedgerow species as to ultimately form a naturalised hedgerow similar to existing in the area. Species shall be whitehorn, blackthorn, hazel and holly Existing Lane DP EP EP EP EP FL FL P P P P P P SF WM WM G G G EAVE EAVE EAVE RIDGE RIDGE RIDGE RIDGE CONCRETE CONCRETE CONCRETE CONCRETE CONCRETE CONCRETE CONCRETE CONCRETE ECC1 112.137 ECC2 107.040 117.49 117.57 1 1 7 . 3 6 1 1 7 . 3 6 1 1 7 . 4 2 117 . 5 2 117 . 5 6 117 . 5 2 117 . 6 2 117 . 5 9 117.84 117.53 120.88 120.19 116 78 116.96 117.17 117.33 117.54 1 1 7 . 3 4 117.42 1 17 . 21 117.40 1 1 7 . 0 0 116.98117.23 117.07 117.19 117.21 117.15 117.31 117 33 1 1 6 . 5 5 117.12116.951 1 6 . 3 3 1 1 6 . 9 3 1 1 6 . 2 1 1 1 6 . 7 6 1 1 6 . 3 9 1 1 6 . 5 3 117.11 117.22116.91 116.91 116.89 116.95 116 81 116 . 6 7 116 85 116 82 117.19 116 . 8 0 116.50 116.65 116.69 116.63 116.72 116.30 116.58 116.62 116.67 116.64 116.59 116.58 116.66 116.74 116.56 116.55 116.50 116.62 116.43 116.67 116.68 116.82 116.82116.57116.40116.3711 6. 62 1 1 6 . 3 7 118.37118.31117.30 116.71116.78116.78 115.65115.71114.29114.09112.871 17 .4 5 112.98111.89111.82111.78 110.86 110.52110.51109.47109.42108.38108.45107.57107.37107.15106.94106.76106.68106.54 106 . 4 7 106 . 4 4 106.59 107.70107.51107.32107.14107.03106.96106.86106.72106 . 6 3 106 . 5 5 106. 4 8 107.32 116.33 115.11 115.00 114.92 114.87 115.02 115.12 115.10 114.56 114.27 114.25 114.59 114.76 115.18 115.57 115.56 115.50 115.41 115.52 115.77 115.98 115.99 116.59 116.45 116.02 115.89 115.92 116.02 116.00 115.77 115.31 114.94 114.80 115.06 115.40 115.82 116.17 116.34 116.32 116.27 116.31 116.52 115.11 115.26 115.39 115.47 115.73 115.79 115.95 115.95 115.30 112.41 121.16 122.77 117.35 114.65 100 100 1 1 1 1 1 1COW DRINKERCONC PIPE 150DIA WOODEN FENCE HT=0.75WOODEN FENCE HT=0.75B A R B E D W I R E H T = 0 . 7 5 B A R B E D W I R E H T = 0 . 7 5 B A R B E D W I R E H T = 0 . 7 5 P r o p o s e d H o u s e F F L : 1 1 7 . 3 0 Aco Drain to perimeter of manure store and concrete apron for soil waste into existing tank Existing Wastewater Tank (Underground 8.8m x 15m x 2.4m) Tydavnet GWS Connection Proposed Storm Water to existing storm drain Concrete Hardstand 804 or similar hardstand and laneway Existing Poultry House and Store Dashed in GREEN to be demolishedA ABBApplicants Dwelling Applicants Parent's Dwelling Covered Manure Loading Area Silt Trap Wastewater Tank (Underground) Aco Drain to perimeter of concrete apron Applicants Sisters Dwelling New hedgerow planting to new site boundary shall incorporate native hedgerow species as to ultimately form a naturalised hedgerow similar to existing in the area. Species shall be whitehorn, blackthorn, hazel and holly B U I L D I NG A B U I L D I NG B B U I L D I NG C 114.10 114.30 114.59114.31114.15 114.60 114.35 114.2 114.65 114.50 114.10 115.5 114.15 115.05 115.01 114.95 B U I L D I NG D FEED SILO P r o p o s e d H o u s e F F L : 1 1 6 . 3 0 Wastewater Tank (Underground) Wastewater Tank (Underground) Aco Drain to perimeter of concrete apron for watstewater FEED SILO Diverter for Clean Water Discharge and Silt Trap Proposed/Improved 70m Sightline shown in yellow Diverter for Clean Water Discharge and Silt Trap Aco Drain to road edge to discharge to watercourse Diverter for Clean Water Discharge to storm water drainage Proposed 70m Sightline shown in yellow Proposed 70m Sightlines shown in yellow taken back 2.4m back from road edge to centre of entrance Proposed 70m Sightline shown in yellow 55m of existing hedgerow to be removed to enable 70m sighline. New hedgerow of native species to be planted behind new fence to replace existing hedge in line with proposed 70m splay line. Section of of existing hedgerow to be removed to enable swing paths for HGV's. New hedgerow of native species to be planted behind new fence to replace existing hedge D c B F A E G H I LANDSCAPING Refer to Landscaping Plan for specific landscaping details of; A-B B-C C-D E-F F-G H-I Site Location Map Scale 1:2500 Townland: Knocknagrave O.S Irish Grid Centre X - 662472 Y - 842683 Existing Poultry House and Store to be demolished Site Outline in RED Land Ownership in BLUE Foul Drainage in ORANGE Storm Drainage in Cyan Site Section A-A Scale 1:500 105.00 110.00 100.00 115.00 120.00 Site Boundary Lane/Site Boundary Lane/Site Boundary 125.00 130.00 Cut Site Section B-B Scale 1:500 105.00 110.00 100.00 115.00 120.00 Site Boundary 125.00 130.00 Site Boundary Cut KEY Rev Description Initials Date Killyloughavoy, Emyvale, Co.Monaghan t: 04787352 m: 0861069485 e:ciaran@mccsurveyors.com Job Title: Poultry Facility for Fergal McCrudden Knocknagrave, Tydavnet, Co.Monaghan Drawing Title: Site Plan and Site Location Map Scale: 1:500 1:2500 Drawn by: CMC Date: Oct 2025 Chk'd by: CMC Job Number: 202533 Drawing Number: FMC04 Revision: P06 McCarron Chartered Building Surveyors Planning|Design |Surveys  RECEIVED: 31/03/2026 EPEPWMGEAVEECC1112.137114.29114.09112.87112.98111.89111.82111.78110.86110.52110.51109.47109.42108.38108.45 114.65111WOODEN FENCE HT=0.752.55m7.80m4.20m3.8m1.36mPATH OF REAR WHEELPATH OF OVERHANGPATH OF FRONT WHEEL30°HGV SWING ANALYSIS 30 °ATROAD ENTRANCE FROM SOUTH SIDEHGV SWING ANALYSIS 150°ATROAD ENTRANCE FROM NORTH SIDEEPEPPPWMGECC1112.137115.65 115.71 114.29 114.09 112.87 112.98 111.89 111.82111.78110.86110.52 110.51 109.47 109.42 1111WOODEN FENCE HT=0. 7 5 A PATH OF FRONT WHEEL150°PATH OF REAR WHEELPATH OF OVERHANG2.55m4.20m6.6m MINIMUM3.8m7.80m1.36mPA T H O F R E A R W H E E L 2 . 5 5m 4 . 2 0m 6.6m M I N I M U M 7 . 8 0m 3 . 8m 1 . 3 6m P A T H O F O V E R HANG P A T H O F F RON T W H E E L 9 0 ° P A T H O F R E A R W H E E L 2. 5 5 m 4. 2 0 m6.6m MINIMUM7. 8 0 m 3. 8 m 1. 3 6 m P A T H O F O V E R H A N G P A T H O F F R O N T W H E E L 90 °FLFLPPEAVERIDGERIDGECONCRETECONCRETECONCRETECONCRETE117.49117.57117.36117.36117.4211 7 . 52 117.56117.52117.621 17 . 5 9117.53120.88120.19116 78116.96117.17117.33117.54117.34117.42117.21117.40117.21117.15117.31117 33116.551 1 7 . 1 2 116.95117.45116.33115.98115.99116.59116.45116.52122.77BARBED WIRE HT=0.75BUILDING BBUILDING DFEEDSILOPATH OF FRONT WHEEL150°PATH OF REAR WHEELPATH OF OVERHANGHGV SWING ANALYSIS WITHIN SITEMcCarronCharteredBuilding SurveyorsRevDescriptionInitialsDateKillyloughavoy,Emyvale,Co.MonaghanH18 AK12t: 04787352m: 0861069485e:ciaran@mccsurveyors.comJob Title:Proposed Poultry Facility atKnocknagrave, Tydavnet, Co.Monaghanfor Fergal McCruddenDrawing Title:Proposed HGV Swing PathsScale:1:200Drawn by:CMCDate:Jan 2026Chk'd by:CMCJob Number:202533Drawing Number:FMC06Revision:P02Planning|Design |Surveys  RECEIVED: 31/03/2026 RECEIVED: 31/03/2026 RECEIVED: 31/03/2026 Date: 10/03/2026 Quotation Euro Client: Fergal Mc Crudden Supply & planting as per scheduled in the adjoining landscape plan : 730 Native hedging Net RECEIVED: 31/03/2026 NSite PlanScale 1:500DPEPEPEPEPFLFLPPPPPPSFWMWMGGGEAVEEAVEEAVERIDGERIDGERIDGERIDGECONCRETECONCRETECONCRETECONCRETECONCRETECONCRETECONCRETECONCRETEECC1112.137ECC2107.040117.49117.57117.36117.36117.42117.52117.56117.52117.62117.59117.84117.53120.88120.19116 78116.96117.17117.33117.541 17 . 34117.421 17 . 21117.40117.00116.98117.23117.07117.19117.21117.15117.31117 33116.55117.12116.95 116.33 1 16 .93 116.21116.76116.39116.53117.11117.22116.91116.91116.89116.95116 81116.67116 85116 82117.19116.80116.50116.65116.69116.63116.72116.30116.58116.62116.67116.64116.59116.58116.66116.74116.56116.55116.50116.62116.43116.67116.68116.82116.82116.57116.40116.37 116.62 116.37 118.37118.31117.30116.71116.78116.78115.65115.71114.29114.09112.87117.45 112.98111.89111.82111.78110.86110.52110.51109.47109.42108.38108.45107.57107.37107.15106.94106.76106.68106.54106.47106.44106.59107.70107.51107.32107.14107.03106.96106.86106.72106.63106.55106.48107.32116.33115.11115.00114.92114.87115.02115.12115.10114.56114.27114.25114.59114.76115.18115.57115.56115.50115.41115.52115.77115.98115.99116.59116.45116.02115.89115.92116.02116.00115.77115.31114.94114.80115.06115.40115.82116.17116.34116.32116.27116.31116.52115.11115.26115.39115.47115.73115.79115.95115.95115.30112.41121.16122.77117.35114.65100100111111COWDRINKERCONC PIPE 150DIAWOODENFENCEHT=0.75WOODENFENCEHT=0.75BARBEDWIRE HT=0.75 BARBEDWIRE HT=0.75 BARBEDWIRE HT=0.75 Proposed HouseFFL: 117.30 ABUILDINGA BUILDINGB BUILDINGC 114.10114.30114.59114.31114.15114.60114.35114.2114.65114.50114.10115.5114.15115.05115.01114.95BUILDINGD FEEDSILOProposed HouseFFL: 116.30 FEEDSILO1:500 Scale:10/03/2026Date:Revision #:1Aidan FlanaganFergal Mc CruddenLandscape Plan:Lough Egish Landscapes LtdLandscape Design by:All existing Hedgerows are to be retained on the boundaries, the optimum height around the boundaries for hedgerow maintenance is 6m.:A-B-C-DBetween all the above listed pts there will be a new native hedgerow to be planted in a double staggered row.There will be 730 hedging in total. Hedging will consist of a broad native mixed variety consisting of: Fagus sylvatica, Quercus robur ,Alder, Birch & Sorbus, Acer pseudoplatanus & Craetagus depending on seasonal availbility in required sizes. The size of hedging at planting will be 60-90cm. To maintain our own long term visibilty in this zone we are taking the following steps.1 .Reducing the crowns of existing trees in the boundary to a hieght of 10m which will encourage a lower tree canopy2. Keepinng existing hedges faced on both sides and regular fertilising to alow the hedge to get the optimum height of 5-6m.3. PLanting trees within boundary now to help the immediate impact while waiting on the hedgerow to get to the target height.A new native hedgerow to be planted betweenpts listed A,B,C&DExisting boundary hedge to be retainedzabcdRECEIVED: 31/03/2026 EPEPWMGEAVEECC1112.137114.29114.09112.87112.98111.89111.82111.78110.86110.52110.51109.47109.42108.38108.45 114.65111WOODEN FENCE HT=0.752.55m7.80m4.20m3.8m1.36mPATH OF REAR WHEELPATH OF OVERHANGPATH OF FRONT WHEEL30°HGV SWING ANALYSIS 30 °ATROAD ENTRANCE FROM SOUTH SIDEHGV SWING ANALYSIS 150°ATROAD ENTRANCE FROM NORTH SIDEEPEPPPWMGECC1112.137115.65 115.71 114.29 114.09 112.87 112.98 111.89 111.82111.78110.86110.52 110.51 109.47 109.42 1111WOODEN FENCE HT=0. 7 5 A PATH OF FRONT WHEEL150°PATH OF REAR WHEELPATH OF OVERHANG2.55m4.20m6.6m MINIMUM3.8m7.80m1.36mPA T H O F R E A R W H E E L 2 . 5 5m 4 . 2 0m 6.6m M I N I M U M 7 . 8 0m 3 . 8m 1 . 3 6m P A T H O F O V E R HANG P A T H O F F RON T W H E E L 9 0 ° P A T H O F R E A R W H E E L 2. 5 5 m 4. 2 0 m6.6m MINIMUM7. 8 0 m 3. 8 m 1. 3 6 m P A T H O F O V E R H A N G P A T H O F F R O N T W H E E L 90 °FLFLPPEAVERIDGERIDGECONCRETECONCRETECONCRETECONCRETE117.49117.57117.36117.36117.4211 7 . 52 117.56117.52117.621 17 . 5 9117.53120.88120.19116 78116.96117.17117.33117.54117.34117.42117.21117.40117.21117.15117.31117 33116.551 1 7 . 1 2 116.95117.45116.33115.98115.99116.59116.45116.52122.77BARBED WIRE HT=0.75BUILDING BBUILDING DFEEDSILOPATH OF FRONT WHEEL150°PATH OF REAR WHEELPATH OF OVERHANGHGV SWING ANALYSIS WITHIN SITEMcCarronCharteredBuilding SurveyorsRevDescriptionInitialsDateKillyloughavoy,Emyvale,Co.MonaghanH18 AK12t: 04787352m: 0861069485e:ciaran@mccsurveyors.comJob Title:Proposed Poultry Facility atKnocknagrave, Tydavnet, Co.Monaghanfor Fergal McCruddenDrawing Title:Proposed HGV Swing PathsScale:1:200Drawn by:CMCDate:Jan 2026Chk'd by:CMCJob Number:202533Drawing Number:FMC06Revision:P02Planning|Design |Surveys